blueTEV, liquid, E. coli

Artikelnummer: TRZ-P2020-138_10KU
Artikelname: blueTEV, liquid, E. coli
Artikelnummer: TRZ-P2020-138_10KU
Hersteller Artikelnummer: P2020-138_10kU
Alternativnummer: TRZ-P2020-138_10KU
Hersteller: trenzyme
Wirt: E. coli
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Alternative Synonym: TEV Protease, TEV, Tobacco Etch Virus nuclear-inclusion-a endopeptidase, rTEV, P1 protease, EC 3.4.22.44
blueTEV represents the catalytic domain of the nuclear inclusion a (NIa) protein with a molecular weight of 27 kDa encoded by the plant virus Tobacco Etch Virus. blue indicates fusion of the protease to blue fluorescent protein (BFP), which leads to in
Molekulargewicht: 53,7 kDa
UniProt: Q0GDU8
Puffer: 50 mM Tris, 150 mM NaCl, 0.5 mM EDTA, 40% Glycerol
Reinheit: > 85% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: KGPRDYNPISSSICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFKVKDTTTLQQHLVDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNE
Formel: pH 8,0