greenTEV, lyophilized formulation, free sample, E. coli Preis auf Anfrage

Artikelnummer: TRZ-P2020-142_200UFREE
Artikelname: greenTEV, lyophilized formulation, free sample, E. coli Preis auf Anfrage
Artikelnummer: TRZ-P2020-142_200UFREE
Hersteller Artikelnummer: P2020-142_200Ufree
Alternativnummer: TRZ-P2020-142_200UFREE
Hersteller: trenzyme
Wirt: E. coli
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Alternative Synonym: TEV Protease, TEV, Tobacco Etch Virus nuclear-inclusion-a endopeptidase, rTEV, P1 protease, EC 3.4.22.44
greenTEV represents the catalytic domain of the nuclear inclusion a (NIa) protein with a molecular weight of 27 kDa encoded by the plant virus Tobacco Etch Virus. green indicates fusion of the protease to green fluorescent protein (GFP), which leads to
Molekulargewicht: 53,7 kDa
UniProt: Q0GDU8
Puffer: 50 mM Tris, 150 mM NaCl, 0.5 mM EDTA, 5% Trehalose
Reinheit: > 85% as determined by SDS-PAGE
Formulierung: lyophilized
Sequenz: KGPRDYNPISSSICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFK VKDTTTLQQHLVDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMV SDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKN FMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNE
Formel: pH 8,0