human Interleukin-10, His-tag, Human

Artikelnummer: TRZ-P2020-144_20
Artikelname: human Interleukin-10, His-tag, Human
Artikelnummer: TRZ-P2020-144_20
Hersteller Artikelnummer: p2020-144_20
Alternativnummer: TRZ-P2020-144_20
Hersteller: trenzyme
Wirt: Human
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Spezies Reaktivität: Human
Alternative Synonym: Interleukin 10, IL-10, IL10, Cytokine synthesis inhibitory factor (CSIF), CSIF Protein, TGIF Protein, GVHDS
Interleukin-10 (IL-10) is a cytokine that plays a crucial role in the regulation of both innate and adaptive immune responses and controls inflammatory processes. It was first identified in the early 1990s and has since been extensively studied for its i
Molekulargewicht: 21,1 kDa
UniProt: P22301
Puffer: PBS
Reinheit: > 90% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGY LGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSK AVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Formel: pH 7,4