human B7-2/CD86, GFP/His-Tag, Human

Artikelnummer: TRZ-P2020-151_100
Artikelname: human B7-2/CD86, GFP/His-Tag, Human
Artikelnummer: TRZ-P2020-151_100
Hersteller Artikelnummer: P2020-151_100
Alternativnummer: TRZ-P2020-151_100
Hersteller: trenzyme
Wirt: Human
Kategorie: Biochemikalien
Applikation: ELISA, FA, Immunostaining, WB
Spezies Reaktivität: Human
Alternative Synonym: CD86, CD86 antigen, T-lymphocyte activation antigen CD86, B7-2, Activation B7-2 antigen, B70, BU63, CTLA-4 counter-receptor B7.2, FUN-1, CD28LG2, LAB72, MGC34413
The cell surface glycoprotein B7-2, also known as cluster of differentiation 86 (CD86), belongs to the B7 family of co-stimulatory molecules, which are expressed on antigen-presenting cells (APCs), including dendritic cells, macrophages and B cells. Rest
Molekulargewicht: 53,9 kDa
UniProt: P42081
Puffer: PBS
Reinheit: > 95 % as determined by SDS-PAGE
Formulierung: liquid
Sequenz: MLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGR TSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPIS NITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSV SFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Formel: pH 7,4