CD28, GFP/His-Tag, Human

Produktübersicht

• Artikelname: CD28, GFP/His-Tag, Human
• Artikelnummer: TRZ-P2020-155_100
• Hersteller Artikelnummer: P2020-155_100
• Alternativnummer: TRZ-P2020-155_100
• Hersteller: trenzyme
• Wirt: Human
• Kategorie: Biochemikalien
• Applikation: ELISA, FA, Immunostaining, WB
• Spezies Reaktivität: Human
• Alternative Synonym: CD28 antigen, T-cell-specific surface glycoprotein CD28, TP44

Produktbeschreibung

Cluster of differentiation 28 (CD28) is a member of the immunoglobulin superfamily representing a type I transmembrane glycoprotein and is constitutively expressed on the surface of more than 80 % CD4+ T cells and 50 % CD8+ T cells in humans, whereas in

Produkteigenschaften

• Molekulargewicht: 43,6 kDa
• UniProt: P10747
• Puffer: PBS
• Reinheit: > 95 % as determined by SDS-PAGE
• Formulierung: liquid
• Sequenz: MNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
• Formel: pH 7,4