human B7-1/CD80, MBP/His-Tag, Human

Artikelnummer: TRZ-P2020-162_100
Artikelname: human B7-1/CD80, MBP/His-Tag, Human
Artikelnummer: TRZ-P2020-162_100
Hersteller Artikelnummer: P2020-162_100
Alternativnummer: TRZ-P2020-162_100
Hersteller: trenzyme
Wirt: Human
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Spezies Reaktivität: Human
Alternative Synonym: T-lymphocyte activation antigen CD80, Activation B7-1 antigen, BB1, CTLA-4 counter-receptor B7.1 (B7), B7-1, CD28LG, CD28LG1, LAB7
The cell surface glycoprotein B7-1, also known as cluster of differentiation 80 (CD80), belongs to the B7 family of co-stimulatory molecules, which are expressed on antigen-presenting cells (APCs), including dendritic cells, macrophages and B cells. Rest
Molekulargewicht: 67,3 kDa
UniProt: P33681
Puffer: PBS
Reinheit: > 95 % as determined by SDS-PAGE
Formulierung: liquid
Sequenz: MVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFD ITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPT SNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSF MCLIKYGHLRVNQTFNWNTTKQEHFPDN
Formel: pH 7,4