human HER2/ErbB2, His-Tag, Human

Artikelnummer: TRZ-P2020-165_100
Artikelname: human HER2/ErbB2, His-Tag, Human
Artikelnummer: TRZ-P2020-165_100
Hersteller Artikelnummer: P2020-165_100
Alternativnummer: TRZ-P2020-165_100
Hersteller: trenzyme
Wirt: Human
Kategorie: Biochemikalien
Applikation: Kinase Assay, WB
Spezies Reaktivität: Human
Alternative Synonym: ERBB2, Receptor tyrosine-protein kinase erbB-2, Metastatic lymph node gene 19 protein (MLN 19), Proto-oncogene Neu, NEU, NGL, Proto-oncogene c-ErbB-2, Tyrosine kinase-type cell surface receptor HER2, HER2, HER-2, p185erbB2, CD340
The human epidermal growth factor receptor 2 (HER2), which is also referred to as ErbB2 as it is encoded by the ERBB2 gene (erythroblastic oncogene B), is a receptor tyrosine kinase that belongs to the epidermal growth factor receptor (EGFR) family. The
Molekulargewicht: 72,1 kDa
UniProt: P04626
Puffer: PBS
Reinheit: > 90 % as determined by SDS-PAGE
Formulierung: liquid
Sequenz: MSTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEV QGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLREL QLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCK GSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNH SGICELHCPA
Formel: pH 7,4