blueTEV Cleavage Kit, E. coli

Artikelnummer: TRZ-P2020-CK3
Artikelname: blueTEV Cleavage Kit, E. coli
Artikelnummer: TRZ-P2020-CK3
Hersteller Artikelnummer: P2020-CK3
Alternativnummer: TRZ-P2020-CK3
Hersteller: trenzyme
Wirt: E. coli
Kategorie: Biochemikalien
Alternative Synonym: TEV Protease, TEV, Tobacco Etch Virus nuclear-inclusion-a endopeptidase, rTEV, P1 protease, EC 3.4.22.44, control protein, reference protein, cleavage control protein, multiple tag control protein, universal reference protein
Including: 1 x blueTEV (P2020-137) 1 x Cleavage and tag control protein (P2020-141) Performance of cleavage conditions can be easily controlled and visualized by SDS-PAGE using the Cleavage and tag control protein. TEV cleavage results in two cleavage pr
Molekulargewicht: 53,7 kDa / 90,5 kDa
UniProt: Q0GDU8
Puffer: blueTEV: 50 mM Tris, 150 mM NaCl, 0.5 mM EDTA, 5% Trehalose, pH 8.0, Cleavage and tag control protein: PBS, pH 7.4
Reinheit: > 85% as determined by SDS-PAGE
Formulierung: lyophilized
Sequenz: blueTEV: KGPRDYNPISSSICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFK VKDTTTLQQHLVDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMV SDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKN FMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNE
Formel: blueTEV: pH 8.0, Cleavage and tag control protein: pH 7.4
Illustration of blueTEV Cleavage Kit
Structural model of Cleavage and tag control protein