ACAA1 (3-ketoacyl-CoA Thiolase, Peroxisomal, Acetyl-CoA Acyltransferase, Beta-ketothiolase, Peroxisomal 3-oxoacyl-CoA Thiolase, ACAA, PTHIO), Mouse

Artikelnummer: USB-122838
Artikelname: ACAA1 (3-ketoacyl-CoA Thiolase, Peroxisomal, Acetyl-CoA Acyltransferase, Beta-ketothiolase, Peroxisomal 3-oxoacyl-CoA Thiolase, ACAA, PTHIO), Mouse
Artikelnummer: USB-122838
Hersteller Artikelnummer: 122838
Alternativnummer: USB-122838-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: IF, WB
Immunogen: Full length human ACAA1, aa1-424 (NP_001598.1).
ACAA1 (acetylCoenzyme A acyltransferase 1), catalyzes the conversion of acyl-CoA and acetyl-CoA to 3-oxoacyl-CoA in the fatty acid oxidation pathway. Deficiency of this enzyme can lead to pseudo-Zellweger syndrome. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 20ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 001598
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.