ATR (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1), Clone: [3F2], Mouse, Monoclonal

Artikelnummer: USB-123751
Artikelname: ATR (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1), Clone: [3F2], Mouse, Monoclonal
Artikelnummer: USB-123751
Hersteller Artikelnummer: 123751
Alternativnummer: USB-123751-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Immunogen: Partial recombinant corresponding to aa2545-2644 from human ATR (NP_001175) with GST tag. MW of the GST tag alone is 26kD.
The protein encoded by this gene belongs the PI3/PI4-kinase family, and is most closely related to ATM, a protein kinase encoded by the gene mutated in ataxia telangiectasia. This protein and ATM share similarity with Schizosaccharomyces pombe rad3, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This kinase has been shown to phosphorylate checkpoint kinase CHK1, checkpoint proteins RAD17, and RAD9, as well as tumor suppressor protein BRCA1. Mutations of this gene are associated with Seckel syndrome. An alternatively spliced transcript variant of this gene has been reported, however, its full length nature is not known. Transcript variants utilizing alternative polyA sites exist. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [3F2]
NCBI: 001184
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.