Cyclin B1 (G2/Mitotic-specific Cyclin-B1, CCNB1, CCNB) (APC), Rabbit

Artikelnummer: USB-125532-APC
Artikelname: Cyclin B1 (G2/Mitotic-specific Cyclin-B1, CCNB1, CCNB) (APC), Rabbit
Artikelnummer: USB-125532-APC
Hersteller Artikelnummer: 125532-APC
Alternativnummer: USB-125532-APC-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human CCNB1, aa1-433 (NP_114172.1).
Cyclins were originally discovered as proteins whose accumulation during the interphase and destruction at mitosis played a critical role in the progression through the eukaryotic cell cycle. It was subsequently found that cyclins control the cell cycle by binding to Ser/Thr cyclin-dependent kinases (CDKs) and regulating their activities. Human cyclins have been grouped into 5 types, A through E, based largely upon sequence similarity. Cyclin B is essential for the control of the cell cycle at the G2/M (mitosis) transition. The expression of cyclin B1 is cell-cycle regulated, peaking at the G2/M transition. It interacts with the CDC2 protein kinase to form a serine/threonine kinase holoenzyme complex also known as maturation promoting factor (MPF), and thus the complex regulates the progression of cells through G2 into M phase. It maps to 5q12 region of human chromosome. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 031966
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).