Cyclin D2 (CCND2, G1/S-specific Cyclin-D2, KIAK0002, MGC102758) (PE), Clone: [3B10], Mouse, Monoclonal

Artikelnummer: USB-125539-PE
Artikelname: Cyclin D2 (CCND2, G1/S-specific Cyclin-D2, KIAK0002, MGC102758) (PE), Clone: [3B10], Mouse, Monoclonal
Artikelnummer: USB-125539-PE
Hersteller Artikelnummer: 125539-PE
Alternativnummer: USB-125539-PE-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, WB
Immunogen: Partial recombinant corresponding to aa190-289 from human CCND2 (AAH10958) with GST tag. MW of the GST tag alone is 26kD.
Cyclins are proteins that regulate cell cycle progression by interacting with cdc2 kinase or related kinases. Human cyclins have been grouped into 5 types, A through E, based largely upon sequence similarity. The D-type cyclins (D1, D2, and D3) are a family of cell cycle regulators involved in the G1/S phase transition of the cell cycle. On binding to cyclin-dependent kinases CDK4 or CDK6 and activation by a CDK-activating kinase complex, the cyclin-CDK complex activates numerous genes involved in DNA synthesis and cell cycle progression. Cyclin D2 a G1 cyclin, is a member of the family of D-type cyclins. Indirect immunofluorescence studies showed that the protein is localized to the nucleus in G0, suggesting a nuclear function for cyclin D2 in quiescent cells. It is found to be associated with the cyclin-dependent kinases, CDK2 and CDK4 and thus mediates the phosphorylation of tumor suppressor protein Rb during growth arrest. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [3B10]
NCBI: 010958
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).