EGFL7 (Epidermal Growth Factor-like Protein 7, EGF-like Protein 7, Multiple Epidermal Growth Factor-like Domains Protein 7, Multiple EGF-like Domains Protein 7, NOTCH4-like Protein, Vascular Endothelial Statin, VE-statin, Zneu1, M

Artikelnummer: USB-126197-FITC
Artikelname: EGFL7 (Epidermal Growth Factor-like Protein 7, EGF-like Protein 7, Multiple Epidermal Growth Factor-like Domains Protein 7, Multiple EGF-like Domains Protein 7, NOTCH4-like Protein, Vascular Endothelial Statin, VE-statin, Zneu1, M
Artikelnummer: USB-126197-FITC
Hersteller Artikelnummer: 126197-FITC
Alternativnummer: USB-126197-FITC-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human EGFL7, aa1-273 (NP_057299.1).
Regulates vascular tubulogenesis in vivo. Inhibits platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration and promotes endothelial cells adhesion to the substrate in vitro. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 016215
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).