EGR1 (Early Growth Response Protein 1, EGR-1, Zinc Finger Protein Krox-24, Transcription Factor Zif268, Nerve Growth Factor-induced Protein A, NGFI-A, Transcription Factor ETR103, Zinc Finger Protein 225, AT225, ZNF225, KROX24) (P

Artikelnummer: USB-126206-PE
Artikelname: EGR1 (Early Growth Response Protein 1, EGR-1, Zinc Finger Protein Krox-24, Transcription Factor Zif268, Nerve Growth Factor-induced Protein A, NGFI-A, Transcription Factor ETR103, Zinc Finger Protein 225, AT225, ZNF225, KROX24) (P
Artikelnummer: USB-126206-PE
Hersteller Artikelnummer: 126206-PE
Alternativnummer: USB-126206-PE-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, IF, IHC, WB
Immunogen: Partial recombinant corresponding to aa444-543 from human EGR1 (NP_001955) with GST tag. MW of the GST tag alone is 26kD.
EGR1 belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [6E8]
NCBI: 001964
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).