F1AA (FEM1B, Protein Fem-1 Homolog B, FEM1b, FEM1-beta, Fem-1-like Death Receptor-binding Protein alpha, Fem-1-like in Apoptotic Pathway Protein alpha, F1A-alpha, KIAA0396) (FITC), Clone: [4B12], Mouse, Monoclonal

Artikelnummer: USB-126538-FITC
Artikelname: F1AA (FEM1B, Protein Fem-1 Homolog B, FEM1b, FEM1-beta, Fem-1-like Death Receptor-binding Protein alpha, Fem-1-like in Apoptotic Pathway Protein alpha, F1A-alpha, KIAA0396) (FITC), Clone: [4B12], Mouse, Monoclonal
Artikelnummer: USB-126538-FITC
Hersteller Artikelnummer: 126538-FITC
Alternativnummer: USB-126538-FITC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA
Immunogen: Partial recombinant corresponding to aa401-490 from FEM1B (NP_056137) with GST tag. MW of the GST tag alone is 26kD.
FEM1B is involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis, it is involved in glucose homeostasis in pancreatic islet. FEM1B is widely expressed, highest expression being found within the testis while more weakly expressed in other tissues. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHL Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [4B12]
NCBI: 015322
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).