FA2H (Fatty Acid 2-hydroxylase, Fatty Acid alpha-hydroxylase, FAAH), Mouse

Artikelnummer: USB-126544
Artikelname: FA2H (Fatty Acid 2-hydroxylase, Fatty Acid alpha-hydroxylase, FAAH), Mouse
Artikelnummer: USB-126544
Hersteller Artikelnummer: 126544
Alternativnummer: USB-126544-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human FA2H, aa1-372 (AAH17049.2).
Required for alpha-hydroxylation of free fatty acids and the formation of alpha-hydroxylated sphingolipids. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFHTLTPEKPHLKTQ Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 017049
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.