FABP1 (Fatty Acid-binding Protein, Liver, Fatty Acid-binding Protein 1, Liver-type Fatty Acid-binding Protein, L-FABP, FABPL) (Biotin), Rabbit

Artikelnummer: USB-126546-BIOTIN
Artikelname: FABP1 (Fatty Acid-binding Protein, Liver, Fatty Acid-binding Protein 1, Liver-type Fatty Acid-binding Protein, L-FABP, FABPL) (Biotin), Rabbit
Artikelnummer: USB-126546-BIOTIN
Hersteller Artikelnummer: 126546-Biotin
Alternativnummer: USB-126546-BIOTIN-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human FABP1, aa1-127 (AAH32801).
FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 032801
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.