FABP5 (Fatty Acid-binding Protein, Epidermal, Epidermal-type Fatty Acid-binding Protein, E-FABP, Fatty Acid-binding Protein 5, Psoriasis-associated Fatty Acid-binding Protein Homolog, PA-FABP) (HRP), Rabbit

Artikelnummer: USB-126554-HRP
Artikelname: FABP5 (Fatty Acid-binding Protein, Epidermal, Epidermal-type Fatty Acid-binding Protein, E-FABP, Fatty Acid-binding Protein 5, Psoriasis-associated Fatty Acid-binding Protein Homolog, PA-FABP) (HRP), Rabbit
Artikelnummer: USB-126554-HRP
Hersteller Artikelnummer: 126554-HRP
Alternativnummer: USB-126554-HRP-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human FABP5, aa1-135 (NP_001435.1).
FABPs have been reported to be involved in the uptake and metabolism of fatty acids, maintenance of cellular membrane fatty acids levels, intracellular trafficking, modulation of specific enzymes of lipid metabolic pathways, as well as in the modulation of cell growth and differentiation. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 001444
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).