FABP6 (Intestinal Bile Acid-binding Protein, I-BABP, Intestinal 15kD Protein, I-15P, Ileal Lipid-binding Protein, ILBP, Fatty Acid-binding Protein 6, Gastrotropin, GT, ILBP, ILLBP), Mouse

Artikelnummer: USB-126555
Artikelname: FABP6 (Intestinal Bile Acid-binding Protein, I-BABP, Intestinal 15kD Protein, I-15P, Ileal Lipid-binding Protein, ILBP, Fatty Acid-binding Protein 6, Gastrotropin, GT, ILBP, ILLBP), Mouse
Artikelnummer: USB-126555
Hersteller Artikelnummer: 126555
Alternativnummer: USB-126555-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human FABP6, aa1-129 (AAH22489).
FABP6 is the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 022489
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.