FADD (Fas-Associated Death Domain Protein, Growth-inhibiting Gene 3 Protein, GIG3, Mediator of Receptor Induced Toxicity, MORT1, MGC8528, Protein FADD) (MaxLight 550), Rabbit

Artikelnummer: USB-126567-ML550
Artikelname: FADD (Fas-Associated Death Domain Protein, Growth-inhibiting Gene 3 Protein, GIG3, Mediator of Receptor Induced Toxicity, MORT1, MGC8528, Protein FADD) (MaxLight 550), Rabbit
Artikelnummer: USB-126567-ML550
Hersteller Artikelnummer: 126567-ML550
Alternativnummer: USB-126567-ML550-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human FADD, aa1-208 (NP_003815.1).
MaxLight(TM)550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor(TM)546, 555, DyLight(TM)549 , Cy3(TM), TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm), Emission (575nm), Extinction Coefficient 150,000. FADD (Fas-associated protein with death domain) is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. This protein is implicated in survival/proliferation and cell cycle progression. FADD functions are also regulated via cellular sublocalization, protein phosphorylation, and inhibitory molecules. Recombinant FADD protein was expressed in E. coli and purified by using conventional chromatography techniques. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 003824
UniProt: Q13158
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)550.