FADD (Fas-Associated Death Domain Protein, Growth-inhibiting Gene 3 Protein, GIG3, Mediator of Receptor Induced Toxicity, MORT1, MGC8528, Protein FADD) (Biotin), IgG1, Clone: [3A12], Mouse, Monoclonal
Artikelnummer:
USB-126568-BIOTIN
- Bilder (0)
| Artikelname: | FADD (Fas-Associated Death Domain Protein, Growth-inhibiting Gene 3 Protein, GIG3, Mediator of Receptor Induced Toxicity, MORT1, MGC8528, Protein FADD) (Biotin), IgG1, Clone: [3A12], Mouse, Monoclonal |
| Artikelnummer: | USB-126568-BIOTIN |
| Hersteller Artikelnummer: | 126568-Biotin |
| Alternativnummer: | USB-126568-BIOTIN-100 |
| Hersteller: | US Biological |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Immunogen: | Partial recombinant corresponding to aa109-208 from FADD (AAH00334) with GST tag. MW of the GST tag alone is 26kD. |
| FADD (Fas-associated protein with death domain) is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. This protein is implicated in survival/proliferation and cell cycle progression. FADD functions are also regulated via cellular sublocalization, protein phosphorylation, and inhibitory molecules. Recombinant FADD protein was expressed in E. coli and purified by using conventional chromatography techniques. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody. |
Produktgarantie und fachkundiger Support
