FADS1 (Fatty Acid Desaturase 1, Delta(5) Fatty Acid Desaturase, D5D, Delta(5) Desaturase, Delta-5 Desaturase, FADSD5, FLJ38956, FLJ90273) (HRP), Clone: [2D9], Mouse, Monoclonal

Artikelnummer: USB-126570-HRP
Artikelname: FADS1 (Fatty Acid Desaturase 1, Delta(5) Fatty Acid Desaturase, D5D, Delta(5) Desaturase, Delta-5 Desaturase, FADSD5, FLJ38956, FLJ90273) (HRP), Clone: [2D9], Mouse, Monoclonal
Artikelnummer: USB-126570-HRP
Hersteller Artikelnummer: 126570-HRP
Alternativnummer: USB-126570-HRP-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IHC, WB
Immunogen: Partial recombinant corresponding to aa1-99 from human FADS1 (NP_037534) with GST tag. MW of the GST tag alone is 26kD.
Component of a lipid metabolic pathway that catalyzes biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Catalyzes the desaturation of dihomo-gamma-linoleic acid (DHGLA) (20:3n-6) and eicosatetraenoic acid (20:4n-3) to generate arachidonic acid (AA) (20:4n-6) and eicosapentaenoic acid (EPA)(20:5n-3) respectively. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPS Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2D9]
NCBI: 013402
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).