ITGA6 (Integrin alpha-6, VLA-6, CD49 Antigen-like Family Member F, CD49f, DKFZp686J01244, FLJ18737) (HRP), Clone: [4C1], Mouse, Monoclonal

Artikelnummer: USB-128628-HRP
Artikelname: ITGA6 (Integrin alpha-6, VLA-6, CD49 Antigen-like Family Member F, CD49f, DKFZp686J01244, FLJ18737) (HRP), Clone: [4C1], Mouse, Monoclonal
Artikelnummer: USB-128628-HRP
Hersteller Artikelnummer: 128628-HRP
Alternativnummer: USB-128628-HRP-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Partial recombinant corresponding to aa24-133 from human ITGA6 (NP_000201) with GST tag. MW of the GST tag alone is 26kD.
Integrins are a family of heterodimeric membrane glycoproteins consisting on non-covalently associated alpha and beta subunits. In general, integrins function as receptors for extracellular matrix proteins. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRGEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAH Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [4C1]
NCBI: 000210
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).