NUDT2 (Nudix-type Motif 2, APAH1, Bis(5-nucleosyl)-tetraphosphatase [Asymmetrical], Diadenosine 5,5-P1,P4-tetraphosphate Asymmetrical Hydrolase, Diadenosine Tetraphosphatase, Ap4A Hydrolase, Ap4Aase, Nucleoside Diphosphate-linked

Artikelnummer: USB-130631
Artikelname: NUDT2 (Nudix-type Motif 2, APAH1, Bis(5-nucleosyl)-tetraphosphatase [Asymmetrical], Diadenosine 5,5-P1,P4-tetraphosphate Asymmetrical Hydrolase, Diadenosine Tetraphosphatase, Ap4A Hydrolase, Ap4Aase, Nucleoside Diphosphate-linked
Artikelnummer: USB-130631
Hersteller Artikelnummer: 130631
Alternativnummer: USB-130631-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Full length recombinant corresponding to aa1-147 from human NUDT2 (AAH04926) with GST tag. MW of the GST tag alone is 26kD.
This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and three transcript variants, all encoding the same protein, have been identified. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [4A4-3C3]
NCBI: 004926
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.