NUDT21 (Cleavage and Polyadenylation Specificity Factor Subunit 5, Cleavage and Polyadenylation Specificity Factor 25kD Subunit, CPSF 25kD Subunit, Pre-mRNA Cleavage Factor Im 25kD Subunit, Nucleoside Diphosphate-linked Moiety X M

Artikelnummer: USB-130632-HRP
Artikelname: NUDT21 (Cleavage and Polyadenylation Specificity Factor Subunit 5, Cleavage and Polyadenylation Specificity Factor 25kD Subunit, CPSF 25kD Subunit, Pre-mRNA Cleavage Factor Im 25kD Subunit, Nucleoside Diphosphate-linked Moiety X M
Artikelnummer: USB-130632-HRP
Hersteller Artikelnummer: 130632-HRP
Alternativnummer: USB-130632-HRP-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IHC, WB
Immunogen: Full length recombinant corresponding to aa1-228 from human NUDT21 (AAH01403) with GST tag. MW of the GST tag alone is 26kD.
CPSF5 is one subunit of a cleavage factor required for 3 RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3 end processing complex and facilitates the recruitement of other processing factors. CPSF5 is the 25kD subunit of the protein complex, which is composed of four polypeptides. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [3F8]
NCBI: 001403
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).