NUSAP1 (Nucleolar and Spindle-associated Protein 1, NuSAP, ANKT, BM-037, PRO0310, BM037, FLJ13421, LNP, NuSAP1, PRO0310p1, Q0310, SAPL), Mouse

Artikelnummer: USB-130660
Artikelname: NUSAP1 (Nucleolar and Spindle-associated Protein 1, NuSAP, ANKT, BM-037, PRO0310, BM037, FLJ13421, LNP, NuSAP1, PRO0310p1, Q0310, SAPL), Mouse
Artikelnummer: USB-130660
Hersteller Artikelnummer: 130660
Alternativnummer: USB-130660-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: IF, WB
Immunogen: Full length human NUSAP1, aa1-226 (NP_057443.1).
Microtubule-associated protein with the capacity to bundle and stabilize microtubules By similarity. May associate with chromosomes and promote the organization of mitotic spindle microtubules around them. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKTGVRFSAATKDNEHKRSLTKTPARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQERKEKKAKVLGMRRGLILAED Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 016359
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.