NVL (Nuclear Valosin-containing Protein-like, NVLp, Nuclear VCP-like Protein), Clone: [3F6], Mouse, Monoclonal

Produktübersicht

• Artikelname: NVL (Nuclear Valosin-containing Protein-like, NVLp, Nuclear VCP-like Protein), Clone: [3F6], Mouse, Monoclonal
• Artikelnummer: USB-130662
• Hersteller Artikelnummer: 130662
• Alternativnummer: USB-130662-100
• Hersteller: US Biological
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Immunogen: Partial recombinant corresponding to aa757-857 from human NVL (NP_002524) with GST tag. MW of the GST tag alone is 26kD.

Produktbeschreibung

Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ILKTITKNGTKPPLDADVNLEAIAGDLRCDCYTGADLSALVREASICALRQEMARQKSGNEKGELKVSHKHFEEAFKKVRSSISKKDQIMYERLQESLSR Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [3F6]
• NCBI: 002533
• Reinheit: Purified by Protein A affinity chromatography.
• Formulierung: Supplied as a liquid in PBS, pH 7.2.