NXT1 (NTF2-related Export Protein 1, Protein p15, MTR2) (Biotin), Rabbit

Artikelnummer: USB-130673-BIOTIN
Artikelname: NXT1 (NTF2-related Export Protein 1, Protein p15, MTR2) (Biotin), Rabbit
Artikelnummer: USB-130673-BIOTIN
Hersteller Artikelnummer: 130673-Biotin
Alternativnummer: USB-130673-BIOTIN-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human NXT1, aa1-140 (AAH00759.1).
The protein encoded by this gene is located in the nuclear envelope. It has protein similarity to nuclear transport factor 2. This protein functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN- and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. The encoded protein heterodimerizes with Tap protein and may regulate the ability of Tap protein to mediate nuclear mRNA export. The use of alternate polyadenylation sites has been found for this gene. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESSSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 000759
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.