PEX11B (Peroxisomal Membrane Protein 11B, Peroxin-11B, Peroxisomal Biogenesis Factor 11B, Protein PEX11 Homolog beta, PEX11-beta) (HRP), Clone: [2D2], Mouse, Monoclonal

Artikelnummer: USB-131166-HRP
Artikelname: PEX11B (Peroxisomal Membrane Protein 11B, Peroxin-11B, Peroxisomal Biogenesis Factor 11B, Protein PEX11 Homolog beta, PEX11-beta) (HRP), Clone: [2D2], Mouse, Monoclonal
Artikelnummer: USB-131166-HRP
Hersteller Artikelnummer: 131166-HRP
Alternativnummer: USB-131166-HRP-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IHC
Immunogen: Partial recombinant corresponding to aa1-99 from PEX11B (NP_003837) with GST tag. MW of the GST tag alone is 26kD.
Involved in peroxisomal proliferation. May regulate peroxisomes division by recruiting the dynamin-related GTPase DNM1L to the peroxisomal membrane. Applications: Suitable for use in ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MDAWVRFSAQSQARERLCRAAQYACSLLGHALQRHGASPELQKQIRQLESHLSLGRKLLRLGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFA Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2D2]
NCBI: 003846
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).