PEX3 (Peroxisomal Biogenesis Factor 3, Peroxin-3, Peroxisomal Assembly Protein PEX3, DKFZp686N14184, FLJ13531) (HRP), Clone: [3C2], Mouse, Monoclonal

Artikelnummer: USB-131175-HRP
Artikelname: PEX3 (Peroxisomal Biogenesis Factor 3, Peroxin-3, Peroxisomal Assembly Protein PEX3, DKFZp686N14184, FLJ13531) (HRP), Clone: [3C2], Mouse, Monoclonal
Artikelnummer: USB-131175-HRP
Hersteller Artikelnummer: 131175-HRP
Alternativnummer: USB-131175-HRP-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Partial recombinant corresponding to aa271-374 from human PEX3 (NP_003621) with GST tag. MW of the GST tag alone is 26kD.
Involved in peroxisome biosynthesis and integrity. Assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, is necessary for the import of peroxisomal membrane proteins in the peroxisomes. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQLEK Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [3C2]
NCBI: 003630
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).