PEX3 (Peroxisomal Biogenesis Factor 3, Peroxin-3, Peroxisomal Assembly Protein PEX3, DKFZp686N14184, FLJ13531) (MaxLight 550), Clone: [3C2], Mouse, Monoclonal

Artikelnummer: USB-131175-ML550
Artikelname: PEX3 (Peroxisomal Biogenesis Factor 3, Peroxin-3, Peroxisomal Assembly Protein PEX3, DKFZp686N14184, FLJ13531) (MaxLight 550), Clone: [3C2], Mouse, Monoclonal
Artikelnummer: USB-131175-ML550
Hersteller Artikelnummer: 131175-ML550
Alternativnummer: USB-131175-ML550-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, WB
Immunogen: Partial recombinant corresponding to aa271-374 from human PEX3 (NP_003621) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor(TM)546, 555, DyLight(TM)549 , Cy3(TM), TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm), Emission (575nm), Extinction Coefficient 150,000. Involved in peroxisome biosynthesis and integrity. Assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, is necessary for the import of peroxisomal membrane proteins in the peroxisomes. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQLEK Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [3C2]
NCBI: 003630
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)550.