PFDN5 (MM1, PFD5, Prefoldin Subunit 5, C-Myc-binding Protein Mm-1, Myc Modulator 1, MGC5329, MGC71907), Mouse

Artikelnummer: USB-131182
Artikelname: PFDN5 (MM1, PFD5, Prefoldin Subunit 5, C-Myc-binding Protein Mm-1, Myc Modulator 1, MGC5329, MGC71907), Mouse
Artikelnummer: USB-131182
Hersteller Artikelnummer: 131182
Alternativnummer: USB-131182-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: IF, WB
Immunogen: Full length human PFDN5, aa1-154.
This gene encodes a member of the prefoldin alpha subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. The encoded protein may also repress the transcriptional activity of the proto-oncogene c-Myc. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 003373
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.