PFKFB2 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2, 6PF-2-K/Fru-2,6-P2ase 2, PFK/FBPase 2, PFK-2/FBPase-2, 6PF-2-K/Fru-2,6-P2ase Heart-type Isozyme, DKFZp781D2217, MGC138308, MGC138310) (Not for Export EU), Rabbit100

Artikelnummer: USB-131185
Artikelname: PFKFB2 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2, 6PF-2-K/Fru-2,6-P2ase 2, PFK/FBPase 2, PFK-2/FBPase-2, 6PF-2-K/Fru-2,6-P2ase Heart-type Isozyme, DKFZp781D2217, MGC138308, MGC138310) (Not for Export EU), Rabbit100
Artikelnummer: USB-131185
Hersteller Artikelnummer: 131185
Alternativnummer: USB-131185-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP
Immunogen: Full length human PFKFB2, aa1-505 (NP_006203.2).
Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains. The AGC kinase group consists of 63 kinases including the cyclic nucleotide-regulated protein kinase (PKA & PKG) family, the diacylglycerol-activated/phospholipid-dependent protein kinase C (PKC) family, the related to PKA and PKC (RAC/Akt) protein kinase family, the kinases that phosphorylate G protein-coupled receptors family (ARK), and the kinases that phosphorylate ribosomal protein S6 family (RSK). Applications: Suitable for use in Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 006212
Reinheit: Serum
Formulierung: Supplied as a liquid.