SLC30A6 (Solute Carrier Family 30 Member 6, Zinc Transporter 6, ZNT6, ZnT-6, MST103, MSTP103) (HRP), Clone: [2G6-G3], Mouse, Monoclonal

Artikelnummer: USB-133475-HRP
Artikelname: SLC30A6 (Solute Carrier Family 30 Member 6, Zinc Transporter 6, ZNT6, ZnT-6, MST103, MSTP103) (HRP), Clone: [2G6-G3], Mouse, Monoclonal
Artikelnummer: USB-133475-HRP
Hersteller Artikelnummer: 133475-HRP
Alternativnummer: USB-133475-HRP-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA
Immunogen: Full length recombinant corresponding to aa1-217 from human SLC30A6 (AAH32525) with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2G6-G3]
NCBI: 032525
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).