Sentrin-2 also known as SUMO-3 is a novel ubiquitin-like protein that can be conjugated to other proteins in a manner analogous to ubiquitination. It is a 95aa peptide that is 46% identical and 66% homologous to sentrin-1. Sentrin interacts with the death domains of Fas, TNFR1 (tumor necrosis factor receptor 1), PML (a tumor suppressor), Rad51 and Rad 52, which are involved in repairing dsDNA breaks, and with GAP1. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
