TMPRSS2 (Transmembrane Protease, Serine 2, Serine Protease 10, Transmembrane Protease, Serine 2 Non-catalytic Chain, Transmembrane Protease, Serine 2 Catalytic Chain, PRSS10, FLJ41954) (HRP), Clone: [2F4], Mouse, Monoclonal100

Artikelnummer: USB-134524-HRP
Artikelname: TMPRSS2 (Transmembrane Protease, Serine 2, Serine Protease 10, Transmembrane Protease, Serine 2 Non-catalytic Chain, Transmembrane Protease, Serine 2 Catalytic Chain, PRSS10, FLJ41954) (HRP), Clone: [2F4], Mouse, Monoclonal100
Artikelnummer: USB-134524-HRP
Hersteller Artikelnummer: 134524-HRP
Alternativnummer: USB-134524-HRP-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Partial recombinant protein corresponding to aa383-492 from human TMPRSS2 with GST tag. MW of the GST tag alone is 26kD.
TMPRSS2 is a protein that belongs to the serine protease family. The protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. Its gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2F4]
NCBI: 005656
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).