TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSI

Artikelnummer: USB-134803-ML650
Artikelname: TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSI
Artikelnummer: USB-134803-ML650
Hersteller Artikelnummer: 134803-ML650
Alternativnummer: USB-134803-ML650-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, IF, IHC, IP, WB
Immunogen: Partial recombinant corresponding to aa1-97 from human TSC22D3 (NP_932174) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor(TM)647, DyLight(TM)649, Cy5(TM) and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm), Emission (676nm), Extinction Coefficient 250,000. The DSIPI protein has homology to porcine DIP (DSIP-immunoreactive peptide). The DSIPI protein contains a highly conserved leucine zipper region and belongs to the TSC-22/DIP/BUN family of transcriptional regulators. DSIPI is postulated to also function as a transcriptional regulator. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQT Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [3A5]
NCBI: 198057
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)650.