Transcription Termination Factor 2 (TTF2, Lodestar Homolog, RNA Polymerase II Termination Factor, Transcription Release Factor 2, F2, HuF2), Clone: [3D11], Mouse, Monoclonal

Produktübersicht

• Artikelname: Transcription Termination Factor 2 (TTF2, Lodestar Homolog, RNA Polymerase II Termination Factor, Transcription Release Factor 2, F2, HuF2), Clone: [3D11], Mouse, Monoclonal
• Artikelnummer: USB-134864
• Hersteller Artikelnummer: 134864
• Alternativnummer: USB-134864-100
• Hersteller: US Biological
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Immunogen: Partial recombinant corresponding to aa2-101 from TTF2 (NP_003585)with GST tag. MW of the GST tag alone is 26kD.

Produktbeschreibung

Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHCLLHEDFVVELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSK* Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [3D11]
• NCBI: 003594
• Reinheit: Purified by Protein A affinity chromatography.
• Formulierung: Supplied as a liquid in PBS, pH 7.2.