USP15 (Ubiquitin-specific-processing Protease 15, Ubiquitin Carboxyl-terminal Hydrolase 15, Deubiquitinating Enzyme 15, Ubiquitin Thioesterase 15, Unph-2, Unph4, KIAA0529) (APC), Clone: [1C10], Mouse, Monoclonal

Produktübersicht

• Artikelname: USP15 (Ubiquitin-specific-processing Protease 15, Ubiquitin Carboxyl-terminal Hydrolase 15, Deubiquitinating Enzyme 15, Ubiquitin Thioesterase 15, Unph-2, Unph4, KIAA0529) (APC), Clone: [1C10], Mouse, Monoclonal
• Artikelnummer: USB-135152-APC
• Hersteller Artikelnummer: 135152-APC
• Alternativnummer: USB-135152-APC-100
• Hersteller: US Biological
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: FLISA, IF, WB
• Immunogen: Full length protein corresponding to aa1-235 from USP15 (AAH20688) with GST tag. MW of the GST tag alone is 26kD.

Produktbeschreibung

Applications: Suitable for use in FLISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQSC Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [1C10]
• NCBI: 020688
• Reinheit: Purified by Protein A affinity chromatography.
• Formulierung: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).