USP20 (Ubiquitin-specific-processing Protease 20, Ubiquitin Carboxyl-terminal Hydrolase 20, Deubiquitinating Enzyme 20, Ubiquitin Thioesterase 20, VHL-interacting Deubiquitinating Enzyme 2, VDU2, hVDU2, KIAA1003, LSFR3A) (Biotin),

Produktübersicht

• Artikelname: USP20 (Ubiquitin-specific-processing Protease 20, Ubiquitin Carboxyl-terminal Hydrolase 20, Deubiquitinating Enzyme 20, Ubiquitin Thioesterase 20, VHL-interacting Deubiquitinating Enzyme 2, VDU2, hVDU2, KIAA1003, LSFR3A) (Biotin),
• Artikelnummer: USB-135162-BIOTIN
• Hersteller Artikelnummer: 135162-Biotin
• Alternativnummer: USB-135162-BIOTIN-100
• Hersteller: US Biological
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Immunogen: Partial recombinant corresponding to aa252-349 from human USP20 (NP_001008563) with GST tag. MW of the GST tag alone is 26kD.

Produktbeschreibung

Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDAD Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [1A6]
• NCBI: 001008563
• Reinheit: Purified by Protein A affinity chromatography.
• Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.