USP20 (Ubiquitin-specific-processing Protease 20, Ubiquitin Carboxyl-terminal Hydrolase 20, Deubiquitinating Enzyme 20, Ubiquitin Thioesterase 20, VHL-interacting Deubiquitinating Enzyme 2, VDU2, hVDU2, KIAA1003, LSFR3A) (FITC), C

Artikelnummer: USB-135162-FITC
Artikelname: USP20 (Ubiquitin-specific-processing Protease 20, Ubiquitin Carboxyl-terminal Hydrolase 20, Deubiquitinating Enzyme 20, Ubiquitin Thioesterase 20, VHL-interacting Deubiquitinating Enzyme 2, VDU2, hVDU2, KIAA1003, LSFR3A) (FITC), C
Artikelnummer: USB-135162-FITC
Hersteller Artikelnummer: 135162-FITC
Alternativnummer: USB-135162-FITC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, WB
Immunogen: Partial recombinant corresponding to aa252-349 from human USP20 (NP_001008563) with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDAD Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [1A6]
NCBI: 001008563
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).