ACTN4 (Alpha-actinin-4, Non-muscle alpha-actinin 4, F-actin Cross-linking Protein) (Biotin), Rabbit

Artikelnummer: USB-137523-BIOTIN
Artikelname: ACTN4 (Alpha-actinin-4, Non-muscle alpha-actinin 4, F-actin Cross-linking Protein) (Biotin), Rabbit
Artikelnummer: USB-137523-BIOTIN
Hersteller Artikelnummer: 137523-Biotin
Alternativnummer: USB-137523-BIOTIN-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: N-terminus of ACTN4 corresponding to LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA
Alpha actinins belong to the spectrin superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Alpha actinin is an actin-binding protein with multiple roles in different cell types. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.625ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.