LAT2 (Large Neutral Amino Acids Transporter Small Subunit 2, L-type Amino Acid Transporter 2, hLAT2, Solute Carrier Family 7 Member 8, SLC7A8) (PE), Rabbit

Produktübersicht

• Artikelname: LAT2 (Large Neutral Amino Acids Transporter Small Subunit 2, L-type Amino Acid Transporter 2, hLAT2, Solute Carrier Family 7 Member 8, SLC7A8) (PE), Rabbit
• Artikelnummer: USB-138079-PE
• Hersteller Artikelnummer: 138079-PE
• Alternativnummer: USB-138079-PE-100
• Hersteller: US Biological
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Immunogen: Synthetic peptide corresponding to PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA

Produktbeschreibung

SLC7A8 is sodium-independent, high-affinity transport of large neutral aa. It has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. SLC7A8 also plays a role in basolateral (re)absorption of neutral aa. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Produkteigenschaften

• Reinheit: Purified by Protein A affinity chromatography.
• Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).