LMAN1 (Protein ERGIC-53, ER-Golgi Intermediate Compartment 53kD Protein, Gp58, Intracellular Mannose-specific Lectin MR60, Lectin Mannose-binding 1, ERGIC53, F5F8D, FMFD1) (HRP), Rabbit

Artikelnummer: USB-138084-HRP
Artikelname: LMAN1 (Protein ERGIC-53, ER-Golgi Intermediate Compartment 53kD Protein, Gp58, Intracellular Mannose-specific Lectin MR60, Lectin Mannose-binding 1, ERGIC53, F5F8D, FMFD1) (HRP), Rabbit
Artikelnummer: USB-138084-HRP
Hersteller Artikelnummer: 138084-HRP
Alternativnummer: USB-138084-HRP-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: Middle region of LMAN1 corresponding to DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNR
LMAN1 is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in its gene are associated with a coagulation defect. Using positional cloning, its gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).