NELL2 (Protein Kinase C-binding Protein NELL2, NEL-like Protein 2, Nel-related Protein 2, NRP2), Rabbit

Produktübersicht

• Artikelname: NELL2 (Protein Kinase C-binding Protein NELL2, NEL-like Protein 2, Nel-related Protein 2, NRP2), Rabbit
• Artikelnummer: USB-138174
• Hersteller Artikelnummer: 138174
• Alternativnummer: USB-138174-100
• Hersteller: US Biological
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Immunogen: Synthetic peptide corresponding to MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG

Produktbeschreibung

NELL2 is a cytoplasmic protein that contains epidermal growth factor (EGF) -like repeats. Heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20C. Stable for 12 months at -20C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. Reconstituted product is stable for 12 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Reinheit: Purified by Protein A affinity chromatography.
• Formulierung: Supplied as a lyophilized powder in PBS. Reconstitute with 100ul dH2O to 1mg/ml.