Source: Recombinant Mouse from E. coli Accession No: Q9WVB4 Fragment: Pro35~Asn119 (Accession No: Q9WVB4) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-PTKCTC SAASVDCHGL GLRAVPRGIP RNAERLDLDR NNITRITKMD FAGLKNLRVL HLEDNQVSII ERGAFQDLKQ LERLRLNKN Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 15.3kD Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
Supplied as lyophilized powder from PBS, pH 7.4, 1mM DTT, 5% trehalose, 0.01% sarcosyl, 0.05% Proclin-300. Reconstitute with sterile PBS to a concentration of 0.1-1mg/ml. Do not vortex.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten