Synthetic human beta-endorphin peptide corresponding to aa1-31, conjugated to BSA. Sequence: YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Human beta-endorphin is a 31 amino acid peptide cleaved from the precursor pro-opiomelanocortin (POMC). It is an endogenous opioid peptide neurotransmitter that interacts with opioid receptors. Applications: Suitable for use in RIA, Immunofluorescence, Immunohistochemistry. Other applications not tested. Recommended Dilution: RIA: 1:10,000. Immunofluorescence: 5-15ug/ml Immunohistochemistry: 5-10ug/ml. (formalin fixed/paraffin embedded tissues, 4% paraformaldehyde fixed frozen tissues) Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20C. Stable for 12 months after receipt at -20C. Reconstitute with PBS. Aliquot to avoid repeated freezing and thawing. Store at -20C. Reconstituted product is stable for 12 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
