Increases cAMP levels in a dose-dependent manner (EC50=4.7nM). Increases tyrosine hydroxylase expression in chromaffin cells. CAS No: 127317-03-7 Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 Sequence: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2 Molecular Formula: C142H224N40O39S Molecular Weight: 3147.7 Solubility: 5% acetic acid (1mg/ml) Primary Target: Increases cAMP levels Cell permeable: No Form: Supplied as a trifluoroacetate salt. Appearance: White to off-white solid Purity: 98% (HPLC) Storage and Stability: Lyophilized powder may be stored at -20C. Stable for 12 months after receipt at -20C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht:
3147.7
Reinheit:
98% (HPLC)
Formulierung:
Supplied as an off-white solid.
CAS Nummer:
[127317-03-7]
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten