ABCG1 (ATP-Binding Cassette, Sub-Family G (WHITE), Member 1, ABC8, MGC34313, WHITE1) (FITC), IgG1, Clone: [2H8], Mouse, Monoclonal

Artikelnummer: USB-242986-FITC
Artikelname: ABCG1 (ATP-Binding Cassette, Sub-Family G (WHITE), Member 1, ABC8, MGC34313, WHITE1) (FITC), IgG1, Clone: [2H8], Mouse, Monoclonal
Artikelnummer: USB-242986-FITC
Hersteller Artikelnummer: 242986-FITC
Alternativnummer: USB-242986-FITC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IF
Immunogen: ABCG1 (AAH29158, 21aa-130aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified. [provided by RefSeq Applications: Suitable for use in Immunofluorescence. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNI Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2H8]
Isotyp: IgG1
NCBI: 29158
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).