CLK3 (CDC-like Kinase 3, FLJ22858, PHCLK3, PHCLK3/152) (FITC), Clone: [7D6], Mouse, Monoclonal

Artikelnummer: USB-244769-FITC
Artikelname: CLK3 (CDC-like Kinase 3, FLJ22858, PHCLK3, PHCLK3/152) (FITC), Clone: [7D6], Mouse, Monoclonal
Artikelnummer: USB-244769-FITC
Hersteller Artikelnummer: 244769-FITC
Alternativnummer: USB-244769-FITC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, IF, IHC, WB
Immunogen: CLK3 (AAH02555, 36aa-136aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
This gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (SR) family of splicing factors. Two transcript variants encoding different isoforms have been found for this gene. Related pseudogenes are located on chromosomes 1 and 9. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [7D6]
NCBI: 02555
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).